PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G19140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARR-B
Protein Properties Length: 637aa    MW: 68399.6 Da    PI: 6.6804
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G19140.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.12e-28149202155
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   kpr++W+ eLH++Fv+av++L G++kA+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  OB03G19140.1 149 KPRVVWSVELHQQFVNAVNHL-GIDKAVPKKILELMNVPGLTRENVASHLQKFRL 202
                   79*******************.********************************8 PP

2Response_reg49.52.3e-1767343109
                   H..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
  Response_reg  43 d..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                   +  +D+i+ D+ mp+mdG++ll+     e++lp+i+++a +  + + + +k Ga d+l Kp+ +eel +
  OB03G19140.1   6 RrgFDVIISDVHMPDMDGFRLLELVGL-EMDLPVIMMSADSRTDIVMKGIKHGACDYLIKPVRMEELKN 73 
                   3359******************87754.558***********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363927.7E-1651620IPR017053Response regulator B-type, plant
CDDcd001561.95E-18178No hitNo description
PROSITE profilePS5011031.683179IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23003.1E-27297No hitNo description
SuperFamilySSF521727.12E-23387IPR011006CheY-like superfamily
PfamPF000721.3E-14773IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5129411.674146205IPR017930Myb domain
SuperFamilySSF466894.12E-20146206IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.7E-30146207IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-25149202IPR006447Myb domain, plants
PfamPF002497.1E-7151200IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MLRENRRGFD VIISDVHMPD MDGFRLLELV GLEMDLPVIM MSADSRTDIV MKGIKHGACD  60
YLIKPVRMEE LKNIWQHVVR KKFNENKDHE HSGSLDDTDR TRPTNNDNEY ASSANDGADG  120
SWKSQKKKRD KDEDDGELES GDPSSTSKKP RVVWSVELHQ QFVNAVNHLG IDKAVPKKIL  180
ELMNVPGLTR ENVASHLQKF RLYLKRIAQH HAGIANPFCP PTSNAKVGSL GGLDFQALAA  240
SGQIPPQALA ALQDELLGRP TNSLVLPGRD QSSLRLPAVK GNKPHGEREI AFGQPIYKCQ  300
NNAYGAFPQS SPAVGGMTPF SAWPNNKLGM ADSSSTLGGM SNSQNSNIVL HELQQQPDAM  360
LSGTLHSLDV KPSGIVMPSQ SLNTFSASEG LSPNQNNLMI SSHSSGYLAA MPPSMKHEPV  420
IATSQPSSSL LVGIDLVNQA STSQPLMSTH GGNLPGLVNR NPNVVPSQGI STFQTPNNPY  480
LVSPNSMGVG TKQPPGVLKT ENSDSLNHSY GYLGDSTPQM DSGLLSSQSK NTQFGLLGQD  540
DITGSWSPLL NAESYGNNIG LSHPGSSSSS FQSSNVALGK LPDQGRGKNH GFVGKGTCIP  600
SRFAVDEIES PTNNLSHSIG SSGDIISPDI FGFSGQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-24145208164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2467800.0AB246780.1 Oryza sativa Japonica Group ORR1 mRNA for B-type response regulator, complete cds.
GenBankAK1118640.0AK111864.1 Oryza sativa Japonica Group cDNA clone:J033025G23, full insert sequence.
GenBankAK1118990.0AK111899.1 Oryza sativa Japonica Group cDNA clone:J023034P21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649659.10.0PREDICTED: two-component response regulator ORR21
RefseqXP_006649660.10.0PREDICTED: two-component response regulator ORR21
SwissprotA2XE310.0ORR21_ORYSI; Two-component response regulator ORR21
TrEMBLJ3LLI80.0J3LLI8_ORYBR; Uncharacterized protein
STRINGOB03G19140.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57963754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.12e-90response regulator 2